Home > Product > Antimicrobial Peptides > Lividin-4

Antimicrobial Peptides

CAT#
AF2635
Sequence
GVFTLIKGATQLIGKTLGKELGKTGLELMACKITNQC
Host Chemicals
Odorrana livida
Length
37
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.