Home > Product > Catalog Peptides > Others > LL-37, Antimicrobial Peptide, human

Others

LL-37, Antimicrobial Peptide, human

[Price Inquiry]
CAT#
L07001
Sequence
[LL-37, 37 aa]
M.W/Mr.
4493.3
Length
37
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.