Home > Product > Antimicrobial Peptides > LL-37 pentamide

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

LL-37 pentamide

[Price Inquiry]
CAT#
AF2657
Sequence
LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS
Host Chemicals
Synthetic construct
Length
37
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.