Home > Product > Antimicrobial Peptides > Locustin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3310
Sequence
ATTGCSCPQCIIFDPICASSYKNGRRGFSSGCHMRCYNRCHGTDYFQISKGSKCI
Host Chemicals
Migratory locust
Length
55
Activity
Gram+,
SwissProt ID
SwissProt ID: P83428
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.