Home > Product > Antimicrobial Peptides > Longicin

Antimicrobial Peptides

CAT#
AF2705
Sequence
GFGCPLNQGACHNHCRSIGRRGGYCAGIIKQTCTCYRK
Host Chemicals
Haemaphysalis longicornis
Length
38
Activity
Antibacterial, Antiparasitic
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.