Home > Product > Antimicrobial Peptides > Longicornsin

Antimicrobial Peptides

Longicornsin

Price Inquiry
CAT#
AF3217
Sequence
DFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPLRPPFMVG
Host Chemicals
Haemaphysalis longicornis
Length
47
Activity
Gram+ & Gram-, Fungi,

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.