Home > Product > Antimicrobial Peptides > Longicornsin

Antimicrobial Peptides

Longicornsin

[Price Inquiry]
CAT#
AF3217
Sequence
DFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPLRPPFMVG
Host Chemicals
Haemaphysalis longicornis
Length
47
Activity
Gram+ & Gram-, Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.