Antimicrobial Peptides

CAT#
AF3082
Sequence
FKKKKRNIGTFVFFAIALFCTVMFAYLLLTNQYVPIDYNVPRYA
Host Chemicals
Lactococcus lactis
Length
44
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.