Home > Product > Antimicrobial Peptides > Lunasin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3034
Sequence
SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD
Host Chemicals
Glycine max
Length
43
Activity
Cancer cells
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.