Home > Product > Catalog Peptides > Others > Luqin-C

Others

CAT#
A27012
Sequence
FYNPRDLVHSGFRPRLCSVSGVEGYPPCVESHSDRKMKNLLDDLFGL
Length
47
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.