Home > Product > Catalog Peptides > Others > [Lys1, Pro2,5,Arg3,4,Tyr6] VIP, human, porcine, rat, ovine

Others

[Lys1, Pro2,5,Arg3,4,Tyr6] VIP, human, porcine, rat, ovine

Price Inquiry
CAT#
V02018
Sequence
KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2
M.W/Mr.
3467.1
Molecular Formula
C154H257N49O40S1
Length
28

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.