Home > Product > Catalog Peptides > Others > [Lys1, Pro2,5,Arg3,4,Tyr6] VIP, human, porcine, rat, ovine

Others

warning All products are for research use only. Not for human use.

[Lys1, Pro2,5,Arg3,4,Tyr6] VIP, human, porcine, rat, ovine

[Price Inquiry]
CAT#
V02018
Sequence
KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2
M.W/Mr.
3467.1
Molecular Formula
C154H257N49O40S1
Length
28
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.