β-Amyloid (1-42), (1-40), (1-46) and Fragments

warning All products are for research use only. Not for human use.

[Lys22] b-Amyloid (1-40)

[Price Inquiry]
CAT#
A13275
Sequence
DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
M.W/Mr.
4329.0
Molecular Formula
C195H300N54O56S1
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.