Home > Product > Catalog Peptides > Others > M-zodatoxin-Lt6b

Others

M-zodatoxin-Lt6b

[Price Inquiry]
CAT#
M17007
Sequence
QAFKTFTPDWNKIRNDAKRMQDNLEQMKKRFNLNL
Length
35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.