CAT# | A13256 |
M.W/Mr. | 4262.8 |
Sequence | MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...
Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...
Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...
Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...