Home > Product > Catalog Peptides > Others > Metastin_MACMU

Others

warning All products are for research use only. Not for human use.

Metastin_MACMU

[Price Inquiry]
CAT#
M13008
Sequence
GASLSSPAESSGSPQRRGLSAPSSRQIPAPQGAVLVQREKDLPNYNW
Modifications
Phosphotyrosine;Phenylalanine amide
Length
47
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.