Home > Product > Antimicrobial Peptides > MMGP1

Antimicrobial Peptides

CAT#
AF2514
Sequence
MLWSASMRIFASAFSTRGLGTRMLMYCSLPSRCWRK
Host Chemicals
marine metagenome (species undefined)
Length
36
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.