Home > Product > Antimicrobial Peptides > Moricin-like peptide C3

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Moricin-like peptide C3

[Price Inquiry]
CAT#
AF2724
Sequence
KVPIGAIKKGGKIIKKGLGVIGAAGTAHEVYSHVKNRQ
Host Chemicals
Galleria mellonella
Length
38
Activity
Antibacterial, Antifungal
SwissProt ID
A5JSU9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.