CAT# | AF2724 |
Sequence | KVPIGAIKKGGKIIKKGLGVIGAAGTAHEVYSHVKNRQ |
Activity | Antibacterial, Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...
Peptide YY is referred to as PYY. Its structure is highly homologous with pancreatic polypeptide (PP) and neurop ...
Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...
Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...