Antimicrobial Peptides

CAT#
AF3101
Sequence
MGAIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINKIIDWIKKHI
Host Chemicals
Enterococcus faecalis MRR 10-3, Enterococcus faecalis 710C
Length
44
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.