CAT# | AF3101 |
Sequence | MGAIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINKIIDWIKKHI |
Activity | Antimicrobial |
Host Chemicals | Enterococcus faecalis MRR 10-3, Enterococcus faecalis 710C | Length | 44 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2894 | Gallin | Inquiry | ||
AF3348 | Rev4 | Inquiry | ||
AF1205 | RV-23 | Inquiry | ||
AF1198 | Brevinin-1CG3 antimicrobial peptide precursor | Inquiry | ||
AF3204 | Viscotoxin A2 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...
Icatibant, sold under the trade name Firazyr, is a plasma kallikrein inhibitor and the bradykinin B2 receptor an ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...