Home > Product > Antimicrobial Peptides > Mram 8

Antimicrobial Peptides

CAT#
AF1916
Sequence
GIPCGESCVFIPCLTSAIDCSCKSKVCYRN
Host Chemicals
Viola philippica
Length
30
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.