Home > Product > Catalog Peptides > Others > Mu-agatoxin-Aa1a

Others

Mu-agatoxin-Aa1a

[Price Inquiry]
CAT#
A30004
Sequence
ECVPENGHCRDWYDECCEGFYCSCRQPPKCICRNNN
Modifications
Asparagine amide;Disulfide bond(4)
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.