Home > Product > Antimicrobial Peptides > Mucroporin

Antimicrobial Peptides

Mucroporin

[Price Inquiry]
CAT#
AF2423
Sequence
GRRKRQMEARFEPQNRNYRKRELDLEKLFANMPDY
Host Chemicals
Lychas mucronatus
Length
35
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.