Home > Product > Antimicrobial Peptides > Mussel defensin MGD-2

Antimicrobial Peptides

Mussel defensin MGD-2

[Price Inquiry]
CAT#
AF2769
Sequence
GFGCPNNYACHQHCKSIRGYCGGYCAGWFRLRCTCYRCG
Host Chemicals
Mytilus galloprovincialis
Length
39
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.