Home > Product > Antimicrobial Peptides > Mussel Defensin MGD-1

Antimicrobial Peptides

Mussel Defensin MGD-1

[Price Inquiry]
CAT#
AF2770
Sequence
GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLPCTCYRCG
Host Chemicals
Mediterranean mussel, Mytilus galloprovincialis
Length
39
Activity
Gram+,
SwissProt ID
PDB ID: 1FJN
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.