Home > Product > Antimicrobial Peptides > Mutacin IV

Antimicrobial Peptides

Mutacin IV

[Price Inquiry]
CAT#
AF3095
Sequence
KVSGGEAVAAIGICATASAAIGGLAGATLVTPYCVGTWGLIRSH
Host Chemicals
Streptococcus mutans UA140
Length
44
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.