Home > Product > Antimicrobial Peptides > Myeloid cathelicidin 3

Antimicrobial Peptides

Myeloid cathelicidin 3

[Price Inquiry]
CAT#
AF2839
Sequence
KRFHSVGSLIQRHQQMIRDKSEATRHGIRIITRPKLLLAS
Host Chemicals
Equus caballus
Length
40
Activity
Antimicrobial
SwissProt ID
O62842
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.