Home > Product > Catalog Peptides > Others > Myotoxin-3

Others

Myotoxin-3

[Price Inquiry]
CAT#
M20003
Sequence
YKRCHKKEGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVN
Modifications
Disulfide bond(3)
Length
43
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.