Home > Product > Antimicrobial Peptides > Myticin C

Antimicrobial Peptides

CAT#
AF3025
Sequence
QEAQSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR
Host Chemicals
Mytilus galloprovincialis
Length
43
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.