Keywords Search Google Search Search

Myticin C

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3025
Sequence	QEAQSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF1318	Brevinin-1SN2	Inquiry
AF2130	Brevinin-2-RA7 peptide precursor	Inquiry
AF1666	Palustrin-1a	Inquiry
AF1465	Variacin	Inquiry
AF1624	CPF-P2	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Ziconotide: Use in the treatment of pain

Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...

Function of dynorphin A (1-13) in ischemic brain injury

Dynorphin A (1-13) [Dyn-A (1-13)] is a short-chain polypeptide containing 13 amino acids and having extensive bi ...

KAI-1678: A novel PKC-epsilon inhibitor

KAI-1678, a synthetic 21-amino acid, is a novel PKC-epsilon (ε-PKC) inhibitor with a molecular weight of 2541 Da ...

Liraglutide for type 2 diabetes and weight loss

Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...

Function of M871 as a Galanin GAL2 Receptor Antagonist

Galanin-(2–13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide (M871) is a novel peptide antagonist selectively recognizing ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Mytilus galloprovincialis
Length	43