Home > Product > Antimicrobial Peptides > Mytimycin

Antimicrobial Peptides

CAT#
AF2177
Sequence
DCCRKPFRKHCWDCTAGTPYYGYSTRNIFGCTC
Host Chemicals
Mytilus edulis
Length
33
Activity
Antifungal
SwissProt ID
P81614
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.