Home > Product > Antimicrobial Peptides > Neuromacin

Antimicrobial Peptides

Neuromacin

[Price Inquiry]
CAT#
AF3327
Sequence
DCYEDWSRCTPGTSFLTGILWKDCHSRCKELGHRGGRCVDSPSKHCPGVLKNNKQCHCY
Host Chemicals
Medicinal leech, Hirudo medicinalis
Length
59
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.