Home > Product > Catalog Peptides > Others > Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat)

Others

Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat)

[Price Inquiry]
CAT#
M03003
Sequence
EIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV
M.W/Mr.
4186.84
Molecular Formula
C182H282N54O52S4
Length
35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.