Home > Product > Catalog Peptides > Others > Neuropeptide K, porcine

Others

Neuropeptide K, porcine

[Price Inquiry]
CAT#
N06013
Sequence
DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2
Molecular Formula
C175H284N52O52S1
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.