Home > Product > Catalog Peptides > Various Products / Cancer Research > Neuropeptide K, porcine

Various Products / Cancer Research

Neuropeptide K, porcine

Price Inquiry
CAT#
N06013
Sequence
DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2
Molecular Formula
C175H284N52O52S1
Length
36

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.