CAT# | N05011 |
M.F/Formula | C175H269N53O54S1 |
M.W/Mr. | 4011.5 |
Sequence | SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
L-ornithine α-ketoglutarate monohydrate, with some synonyms like OKG, OAKG and L-ornithine 2-oxoglutarate monohy ...
ICI 174,864 is an opioid peptide, belonging to subclasses of opioid receptors. Its chemical structure is N, N-di ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...
IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...
Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...