Home > Product > Catalog Peptides > Others > Neuropeptide Y (3-36), human

Others

Neuropeptide Y (3-36), human

[Price Inquiry]
CAT#
N05011
Sequence
SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
M.W/Mr.
4011.5
Molecular Formula
C175H269N53O54S1
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.