Home > Product > Catalog Peptides > Others > Neuropeptide Y, human

Others

Neuropeptide Y, human

[Price Inquiry]
CAT#
N05026
Sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
M.W/Mr.
4271.8
Molecular Formula
C189H285N55O57S1
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.