Keywords Search Google Search Search

Neuropeptide Y

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2556
Sequence	YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Activity	Antifungal

CAT#	Product Name	Inquiry
AF028	Oligoventin	Inquiry
AF2110	Styelin E	Inquiry
AF3351	Temporin A, amide	Inquiry
AF3153	Salivaricin P	Inquiry
AF1469	Ocellatin-F1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Palmitoyl pentapeptide-4

An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...

An antiplatelet drug of the glycoprotein IIb/IIIa inhibitor class - Eptifibatide Acetate

Eptifibatide acetate is a white or white-off powder, soluble in water and freely soluble in 1% acetic in water, ...

Effect of GRF (Human) Acetate on Growth Hormone

Growth hormone releasing factor (GRF) (human) acetate is an acetate salt of an amidated synthetic 29-amino acid ...

Function of caprooyl tetrapeptide-3 in skin

Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...

Compstatin: a pharmaceutical inhibitor of complement

Compstatin is a 13-residue cyclic peptide (Ile1-Cys2-Val3-Val4-Gln5-Asp6-Trp7-Gly8-His9-His10-Arg11-Cys12-Thr13- ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Homo sapiens
Length	36