Home > Product > Antimicrobial Peptides > Neuropeptide Y

Antimicrobial Peptides

Neuropeptide Y

[Price Inquiry]
CAT#
AF2556
Sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Host Chemicals
Homo sapiens
Length
36
Activity
Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.