Home > Product > Catalog Peptides > Others > Neurotoxin B-IV

Others

warning All products are for research use only. Not for human use.

Neurotoxin B-IV

[Price Inquiry]
CAT#
N10001
Sequence
ASATWGAAYPACENNCRKKYDLCIRCQGKWAGKRGKCAAHCIIQKNNCKGKCKKE
Length
55
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.