Home > Product > Antimicrobial Peptides > Neutrophil antibiotic peptide NP-3B

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Neutrophil antibiotic peptide NP-3B

[Price Inquiry]
CAT#
AF2359
Sequence
GRCVCRKQLLCSYRERRIGDCKIRGVRFPFCCPR
Host Chemicals
Oryctolagus cuniculus
Length
34
Activity
Antimicrobial
SwissProt ID
P07468
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.