Home > Product > Antimicrobial Peptides > Neutrophil beta defensin 12

Antimicrobial Peptides

Neutrophil beta defensin 12

[Price Inquiry]
CAT#
AF2512
Sequence
LLALLFLVLSAGSGFTQGVGNPVSCARNKGICVPSR
Host Chemicals
Bubalus bubalis
Length
36
Activity
Antimicrobial
SwissProt ID
C7E003
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.