Home > Product > Antimicrobial Peptides > Neutrophil beta defensin 12

Antimicrobial Peptides

Neutrophil beta defensin 12

Price Inquiry
CAT#
AF2512
Sequence
LLALLFLVLSAGSGFTQGVGNPVSCARNKGICVPSR
Host Chemicals
Bubalus bubalis
Length
36
Activity
Antimicrobial
SwissProt ID
C7E003

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.