Home > Product > Antimicrobial Peptides > Neutrophil cationic antibacterial polypeptide of 11 kDa

Antimicrobial Peptides

Neutrophil cationic antibacterial polypeptide of 11 kDa

[Price Inquiry]
CAT#
AF3002
Sequence
GLRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI
Host Chemicals
Cavia porcellus
Length
43
Activity
Antibacterial
SwissProt ID
Q91X12
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.