Home > Product > Antimicrobial Peptides > Neutrophil cationic peptide 2 precursor

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Neutrophil cationic peptide 2 precursor

[Price Inquiry]
CAT#
AF2057
Sequence
RRCICTTRTCRFPYRRLGTCLFQNRVYTFCC
Host Chemicals
Cavia porcellus
Length
31
Activity
Antibacterial, Antifungal, Antiviral
SwissProt ID
P49112
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.