Home > Product > Antimicrobial Peptides > Neutrophil cationic peptide 1 type B preproprotein

Antimicrobial Peptides

Neutrophil cationic peptide 1 type B preproprotein

[Price Inquiry]
CAT#
AF1967
Sequence
RCICTTRTCRFPYRRLGTCIFQNRVYTFCC
Host Chemicals
Cavia porcellus
Length
30
Activity
Antibacterial, Antiviral, Antifungal
SwissProt ID
Q64365
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.