Home > Product > Antimicrobial Peptides > Neutrophil cationic peptide 1 type B preproprotein

Antimicrobial Peptides

Neutrophil cationic peptide 1 type B preproprotein

Price Inquiry
CAT#
AF1967
Sequence
RCICTTRTCRFPYRRLGTCIFQNRVYTFCC
Host Chemicals
Cavia porcellus
Length
30
Activity
Antibacterial, Antiviral, Antifungal
SwissProt ID
Q64365

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.