Home > Product > Antimicrobial Peptides > Neutrophil defensin 1

Antimicrobial Peptides

Neutrophil defensin 1

[Price Inquiry]
CAT#
AF1862
Sequence
ACYCRIPACLAGERRYGTCFYLGRVWAFCC
Host Chemicals
Macaca mulatta
Length
30
Activity
Antibacterial, Antifungal
SwissProt ID
P60030
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.