Home > Product > Antimicrobial Peptides > Neutrophil defensin 2

Antimicrobial Peptides

Neutrophil defensin 2

[Price Inquiry]
CAT#
AF1864
Sequence
ACYCRIPACLAGERRYGTCFYMGRVWAFCC
Host Chemicals
Macaca mulatta
Length
30
Activity
Antibacterial, Antifungal
SwissProt ID
P82317
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.