Antimicrobial Peptides

CAT#
AF3319
Sequence
LEYKGECFTKDNTCKYKIDGKTYLAKCPSAANTKCEKDGNKCTYDSYNRKVKCDFRH
Host Chemicals
Neosartorya fischeri
Length
57
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.