Home > Product > Antimicrobial Peptides > NLP-31

Antimicrobial Peptides

CAT#
AF3303
Sequence
QWGYGGYGRGYGGYGGYGRGYGGYGGYGRGYGGYGRGMYGGYGRPYGGYGWGK
Host Chemicals
Caenorhabditis elegans
Length
53
Activity
Gram+ & Gram-, Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.