Home > Product > Antimicrobial Peptides > NmDef02

Antimicrobial Peptides

CAT#
AF3167
Sequence
RECKAQGRHGTCFRDANCVQVCEKQAGWSHGDCRAQFKCKCIFEC
Host Chemicals
Nicotiana megalosiphon
Length
45
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.