Home > Product > Catalog Peptides > Others > Noxa A BH3 peptide, cell permeable

Others

Noxa A BH3 peptide, cell permeable

[Price Inquiry]
CAT#
C08174
Sequence
DRDRDRDRDRDRDRDRGAELPPEFAAQLRKIGDKVYC
M.W/Mr.
3555.2
Length
37
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.