Home > Product > Catalog Peptides > Others > NPSF (1-37), Neuropeptide SF (1-37)

Others

NPSF (1-37), Neuropeptide SF (1-37)

[Price Inquiry]
CAT#
A25019
Sequence
SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF-NH2
M.W/Mr.
4257
Length
37
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.