Home > Product > Antimicrobial Peptides > Ns-D2

Antimicrobial Peptides

CAT#
AF3262
Sequence
KFCEKPSGTWSGVCGNSGACKDQCIRLEGAKHGSCNYKLPAHRCICYYEC
Host Chemicals
seeds, Nigella sativa L.
Length
50
Activity
Gram+ & Gram-, Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.