Home > Product > Antimicrobial Peptides > OaBac6

Antimicrobial Peptides

CAT#
AF3296
Sequence
RRLRPRHQHFPSERPWPKPLPLPLPRPGPRPWPKPLPLPLPRPGLRPWPKPL
Host Chemicals
Sheep
Length
52
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.