Home > Product > Antimicrobial Peptides > OdP2a

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2712
Sequence
GLLSGILGAGKHIVCGLSGPCQSLNRKSSDVEYHLAKC
Host Chemicals
Odorrana grahami
Length
38
Activity
Antibacterial, Antifungal
SwissProt ID
A6MBR1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.