CAT# | AF2712 |
Sequence | GLLSGILGAGKHIVCGLSGPCQSLNRKSSDVEYHLAKC |
Activity | Antibacterial, Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...