Home > Product > Antimicrobial Peptides > Oh-defensin

Antimicrobial Peptides

Oh-defensin

[Price Inquiry]
CAT#
AF3295
Sequence
MLCKLSMFGAVLGVPACAIDCLPMGKTGGSCEGGVCGCRKLTFKILWDKKFG
Host Chemicals
Venoms, Ornithoctonus hainana
Length
52
Activity
Gram+ & Gram-, Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.